SCOPe 2.06: Domain d3giub1: 3giu B:1-212

Lineage for d3giub1 (3giu B:1-212)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.0: automated matches [191433] (1 protein)
   not a true family

6. Protein automated matches [190623] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [188817] (1 PDB entry)

8. Domain d3giub1: 3giu B:1-212 [176671]
   Other proteins in same PDB: d3giub2
   automated match to d1auga_
   complexed with acy, gol, peg, pg4, zn

Details for d3giub1

PDB Entry: 3giu, 1.25 Å

PDB Description: 1.25 angstrom crystal structure of pyrrolidone-carboxylate peptidase (pcp) from staphylococcus aureus

PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d3giub1:

Sequence; same for both SEQRES and ATOM records:

>d3giub1 c.56.4.0 (B:1-212) automated matches {Staphylococcus aureus [TaxId: 93062]}
mhilvtgfapfdnqninpsweavtqlediigthtidklklptsfkkvdniinktlasnhy
dvvlaigqaggrnaitpervainiddaripdnddfqpidqaihldgapayfsnlpvkamt
qsiinqglpgalsnsagtfvcnhtlyhlgylqdkhyphlrfgfihvpyipeqvigkpdtp
smplekivagltaaieaisndedlhlalgtte

Timeline for d3giub1:

• d3giub1 first appeared in SCOPe 2.01, called d3giub_
  
• d3giub1 was called d3giub_ in SCOPe 2.05
  
• d3giub1 appears in SCOPe 2.07
  
• d3giub1 appears in the current release, SCOPe 2.08