SCOPe 2.05: Domain d3giua_: 3giu A:

Lineage for d3giua_ (3giu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.0: automated matches [191433] (1 protein)
   not a true family

6. Protein automated matches [190623] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [188817] (1 PDB entry)

8. Domain d3giua_: 3giu A: [176670]
   automated match to d1auga_
   complexed with acy, gol, peg, pg4, zn

Details for d3giua_

PDB Entry: 3giu, 1.25 Å

PDB Description: 1.25 angstrom crystal structure of pyrrolidone-carboxylate peptidase (pcp) from staphylococcus aureus

PDB Compounds: (A:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d3giua_:

Sequence; same for both SEQRES and ATOM records:

>d3giua_ c.56.4.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mhilvtgfapfdnqninpsweavtqlediigthtidklklptsfkkvdniinktlasnhy
dvvlaigqaggrnaitpervainiddaripdnddfqpidqaihldgapayfsnlpvkamt
qsiinqglpgalsnsagtfvcnhtlyhlgylqdkhyphlrfgfihvpyipeqvigkpdtp
smplekivagltaaieaisndedlhlalgtte

Timeline for d3giua_:

• d3giua_ first appeared in SCOPe 2.01
  
• d3giua_ appears in SCOPe 2.04
  
• d3giua_ appears in SCOPe 2.06
  
• d3giua_ appears in the current release, SCOPe 2.08