Lineage for d3gi4a_ (3gi4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799397Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2800158Domain d3gi4a_: 3gi4 A: [176661]
    automated match to d1kzka_
    complexed with act, k60, po4

Details for d3gi4a_

PDB Entry: 3gi4 (more details), 1.85 Å

PDB Description: crystal structure of protease inhibitor, kb60 in complex with wild type hiv-1 protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3gi4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gi4a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3gi4a_:

Click to download the PDB-style file with coordinates for d3gi4a_.
(The format of our PDB-style files is described here.)

Timeline for d3gi4a_: