Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein Aldose reductase (aldehyde reductase) [51436] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [51437] (135 PDB entries) Uniprot P15121 |
Domain d3ghua_: 3ghu A: [176653] automated match to d1el3a_ complexed with cit, ldt, ndp |
PDB Entry: 3ghu (more details), 1.2 Å
SCOPe Domain Sequences for d3ghua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ghua_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca llsctshkdypfheef
Timeline for d3ghua_: