Lineage for d3ghqg_ (3ghq G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701406Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2701458Species Escherichia coli K-12 [TaxId:83333] [188868] (9 PDB entries)
  8. 2701539Domain d3ghqg_: 3ghq G: [176644]
    automated match to d1bcfa_
    complexed with fe, hem, so4; mutant

Details for d3ghqg_

PDB Entry: 3ghq (more details), 2.7 Å

PDB Description: crystal structure of e. coli w35f bfr mutant
PDB Compounds: (G:) bacterioferritin

SCOPe Domain Sequences for d3ghqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ghqg_ a.25.1.1 (G:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]}
mkgdtkvinylnkllgnelvainqyflharmfknfglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3ghqg_:

Click to download the PDB-style file with coordinates for d3ghqg_.
(The format of our PDB-style files is described here.)

Timeline for d3ghqg_: