Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
Species Escherichia coli K-12 [TaxId:83333] [188868] (6 PDB entries) |
Domain d3ghqe_: 3ghq E: [176642] automated match to d1bcfa_ complexed with fe, hem, so4; mutant |
PDB Entry: 3ghq (more details), 2.7 Å
SCOPe Domain Sequences for d3ghqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ghqe_ a.25.1.1 (E:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]} mkgdtkvinylnkllgnelvainqyflharmfknfglkrlndveyhesidemkhadryie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqireeg
Timeline for d3ghqe_: