Lineage for d3ghqe_ (3ghq E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1989629Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 1989681Species Escherichia coli K-12 [TaxId:83333] [188868] (6 PDB entries)
  8. 1989724Domain d3ghqe_: 3ghq E: [176642]
    automated match to d1bcfa_
    complexed with fe, hem, so4; mutant

Details for d3ghqe_

PDB Entry: 3ghq (more details), 2.7 Å

PDB Description: crystal structure of e. coli w35f bfr mutant
PDB Compounds: (E:) bacterioferritin

SCOPe Domain Sequences for d3ghqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ghqe_ a.25.1.1 (E:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]}
mkgdtkvinylnkllgnelvainqyflharmfknfglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3ghqe_:

Click to download the PDB-style file with coordinates for d3ghqe_.
(The format of our PDB-style files is described here.)

Timeline for d3ghqe_: