Lineage for d3ghca_ (3ghc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153920Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2153968Species Human (Homo sapiens) [TaxId:9606] [53607] (73 PDB entries)
  8. 2153975Domain d3ghca_: 3ghc A: [176635]
    automated match to d1dlra_
    complexed with ghc, ndp, so4

Details for d3ghca_

PDB Entry: 3ghc (more details), 1.3 Å

PDB Description: design, synthesis, and x-ray crystal structure of classical and nonclassical 2-amino-4-oxo-5-substituted-6-thieno[2,3-d]pyrimidines as dual thymidylate synthase and dihydrofolate reductase inhibitors and as potential antitumor agenst
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3ghca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ghca_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdlpwpplrnefryfsrmtttssvegkqnlvimgkktwfsi
peksrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d3ghca_:

Click to download the PDB-style file with coordinates for d3ghca_.
(The format of our PDB-style files is described here.)

Timeline for d3ghca_: