Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [53607] (73 PDB entries) |
Domain d3ghca_: 3ghc A: [176635] automated match to d1dlra_ complexed with ghc, ndp, so4 |
PDB Entry: 3ghc (more details), 1.3 Å
SCOPe Domain Sequences for d3ghca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ghca_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} vgslncivavsqnmgigkngdlpwpplrnefryfsrmtttssvegkqnlvimgkktwfsi peksrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe vyeknd
Timeline for d3ghca_: