Lineage for d3gh3b_ (3gh3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466660Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2466906Family c.23.14.0: automated matches [191355] (1 protein)
    not a true family
  6. 2466907Protein automated matches [190390] (4 species)
    not a true protein
  7. 2466911Species Cow (Bos taurus) [TaxId:9913] [189273] (2 PDB entries)
  8. 2466915Domain d3gh3b_: 3gh3 B: [176634]
    automated match to d2ef1a1
    complexed with cac, nag, so4

Details for d3gh3b_

PDB Entry: 3gh3 (more details), 1.8 Å

PDB Description: structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
PDB Compounds: (B:) Ecto-NAD+ glycohydrolase (CD38 molecule)

SCOPe Domain Sequences for d3gh3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gh3b_ c.23.14.0 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
glnrwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckatke
dynslinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgepgs
sdlniwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifgrv
eapnlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqflqr
s

SCOPe Domain Coordinates for d3gh3b_:

Click to download the PDB-style file with coordinates for d3gh3b_.
(The format of our PDB-style files is described here.)

Timeline for d3gh3b_: