Lineage for d1c72a1 (1c72 A:85-217)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3698Species Chicken (Gallus gallus), class mu [47624] (2 PDB entries)
  8. 3701Domain d1c72a1: 1c72 A:85-217 [17663]
    Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2

Details for d1c72a1

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

SCOP Domain Sequences for d1c72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72a1 a.45.1.1 (A:85-217) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOP Domain Coordinates for d1c72a1:

Click to download the PDB-style file with coordinates for d1c72a1.
(The format of our PDB-style files is described here.)

Timeline for d1c72a1: