Lineage for d3ggua_ (3ggu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799342Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)
  8. 2799379Domain d3ggua_: 3ggu A: [176623]
    automated match to d1sgua_
    complexed with 017

Details for d3ggua_

PDB Entry: 3ggu (more details), 1.8 Å

PDB Description: hiv pr drug resistant patient's variant in complex with darunavir
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ggua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ggua_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwqrpivtvkiegqlkealldtgaddtvfeeltlsgrwkprliggiggfvrvrqyd
qvpieicghkvidtvlvgptptnvigrnvmtqlgctlnf

SCOPe Domain Coordinates for d3ggua_:

Click to download the PDB-style file with coordinates for d3ggua_.
(The format of our PDB-style files is described here.)

Timeline for d3ggua_: