SCOPe 2.07: Domain d3ggua_: 3ggu A:

Lineage for d3ggua_ (3ggu A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)

8. Domain d3ggua_: 3ggu A: [176623]
   automated match to d1sgua_
   complexed with 017

Details for d3ggua_

PDB Entry: 3ggu, 1.8 Å

PDB Description: HIV PR drug resistant patient's variant in complex with darunavir

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ggua_:

Sequence; same for both SEQRES and ATOM records:

>d3ggua_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwqrpivtvkiegqlkealldtgaddtvfeeltlsgrwkprliggiggfvrvrqyd
qvpieicghkvidtvlvgptptnvigrnvmtqlgctlnf

Timeline for d3ggua_:

• d3ggua_ first appeared in SCOPe 2.01
  
• d3ggua_ appears in SCOPe 2.06