SCOPe 2.08: Domain d3ggja_: 3ggj A:

Lineage for d3ggja_ (3ggj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries)

8. Domain d3ggja_: 3ggj A: [176621]
   automated match to d1bzya_
   complexed with 25h

Details for d3ggja_

PDB Entry: 3ggj, 2.6 Å

PDB Description: Human hypoxanthine-guanine phosphoribosyltransferase in complex with 9-(2-phosphonoethoxyethyl)guanine

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d3ggja_:

Sequence; same for both SEQRES and ATOM records:

>d3ggja_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

Timeline for d3ggja_:

• d3ggja_ first appeared in SCOPe 2.01
  
• d3ggja_ appears in SCOPe 2.07