![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries) |
![]() | Domain d3ggcb_: 3ggc B: [176620] automated match to d1bzya_ complexed with h26 |
PDB Entry: 3ggc (more details), 2.78 Å
SCOPe Domain Sequences for d3ggcb_:
Sequence, based on SEQRES records: (download)
>d3ggcb_ c.61.1.1 (B:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} rspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiv alcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddls tltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfei pdkfvvgyaldyneyfrdlnhvcvisetgkakyka
>d3ggcb_ c.61.1.1 (B:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} rspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghiva lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikvigddlstl tgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipd kfvvgyaldyneyfrdlnhvcvisetgkakyka
Timeline for d3ggcb_: