Lineage for d3gg3b_ (3gg3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 protein domains)
  6. 2316873Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 2316874Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 2316876Domain d3gg3b_: 3gg3 B: [176611]
    automated match to d1jm4b_
    complexed with cl

Details for d3gg3b_

PDB Entry: 3gg3 (more details), 2.25 Å

PDB Description: crystal structure of the bromodomain of human pcaf
PDB Compounds: (B:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d3gg3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg3b_ a.29.2.1 (B:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
kklfmadlqrvftnckeynppeseyykcanilekfffskikeag

SCOPe Domain Coordinates for d3gg3b_:

Click to download the PDB-style file with coordinates for d3gg3b_.
(The format of our PDB-style files is described here.)

Timeline for d3gg3b_: