Lineage for d3gfsl_ (3gfs L:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838784Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
    Pfam PF03358
  6. 1838808Protein automated matches [190892] (2 species)
    not a true protein
  7. 1838809Species Bacillus subtilis [TaxId:1423] [189046] (3 PDB entries)
  8. 1838821Domain d3gfsl_: 3gfs L: [176603]
    automated match to d1nni1_
    complexed with fmn

Details for d3gfsl_

PDB Entry: 3gfs (more details), 2.1 Å

PDB Description: structure of yhda, k109d/d137k variant
PDB Compounds: (L:) FMN-dependent NADPH-azoreductase

SCOPe Domain Sequences for d3gfsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gfsl_ c.23.5.4 (L:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggdgginalnnmrtvm
rgvyanvipkqlvlkpvhidvenatvaenikesikelveelsmfak

SCOPe Domain Coordinates for d3gfsl_:

Click to download the PDB-style file with coordinates for d3gfsl_.
(The format of our PDB-style files is described here.)

Timeline for d3gfsl_: