Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins) Pfam PF03358 |
Protein automated matches [190892] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189046] (3 PDB entries) |
Domain d3gfrb_: 3gfr B: [176589] automated match to d1nni1_ complexed with fmn |
PDB Entry: 3gfr (more details), 2.4 Å
SCOPe Domain Sequences for d3gfrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gfrb_ c.23.5.4 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm rgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfaka
Timeline for d3gfrb_: