Lineage for d1gscb1 (1gsc B:85-217)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 213954Protein Class mu GST [81348] (3 species)
  7. 213988Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (14 PDB entries)
  8. 214018Domain d1gscb1: 1gsc B:85-217 [17658]
    Other proteins in same PDB: d1gsca2, d1gscb2, d1gscc2, d1gscd2

Details for d1gscb1

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gscb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gscb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d1gscb1:

Click to download the PDB-style file with coordinates for d1gscb1.
(The format of our PDB-style files is described here.)

Timeline for d1gscb1: