Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) |
Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins) automatically mapped to Pfam PF00932 |
Protein automated matches [191072] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188979] (3 PDB entries) |
Domain d3gefd1: 3gef D:436-552 [176579] Other proteins in same PDB: d3gefa2, d3gefb2, d3gefc2, d3gefd2 automated match to d1ivta_ mutant |
PDB Entry: 3gef (more details), 1.5 Å
SCOPe Domain Sequences for d3gefd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gefd1 b.1.16.1 (D:436-552) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqvv tiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
Timeline for d3gefd1: