![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) ![]() |
![]() | Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins) automatically mapped to Pfam PF00932 |
![]() | Protein automated matches [191072] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188979] (3 PDB entries) |
![]() | Domain d3gefb1: 3gef B:436-552 [176577] Other proteins in same PDB: d3gefa2, d3gefb2, d3gefc2, d3gefd2 automated match to d1ivta_ mutant |
PDB Entry: 3gef (more details), 1.5 Å
SCOPe Domain Sequences for d3gefb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gefb1 b.1.16.1 (B:436-552) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqvv tiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
Timeline for d3gefb1: