SCOPe 2.06: Domain d3gefa1: 3gef A:436-552

Lineage for d3gefa1 (3gef A:436-552)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families)

5. Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins)
   automatically mapped to Pfam PF00932

6. Protein automated matches [191072] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188979] (1 PDB entry)

8. Domain d3gefa1: 3gef A:436-552 [176576]
   Other proteins in same PDB: d3gefa2, d3gefb2, d3gefc2, d3gefd2
   automated match to d1ivta_
   mutant

Details for d3gefa1

PDB Entry: 3gef, 1.5 Å

PDB Description: crystal structure of the r482w mutant of lamin a/c

PDB Compounds: (A:) Lamin-A/C

SCOPe Domain Sequences for d3gefa1:

Sequence; same for both SEQRES and ATOM records:

>d3gefa1 b.1.16.1 (A:436-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqvv
tiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved

Timeline for d3gefa1:

• d3gefa1 first appeared in SCOPe 2.01, called d3gefa_
  
• d3gefa1 was called d3gefa_ in SCOPe 2.05
  
• d3gefa1 appears in SCOPe 2.07
  
• d3gefa1 appears in the current release, SCOPe 2.08