Lineage for d3gefa1 (3gef A:436-552)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764999Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2765000Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins)
    automatically mapped to Pfam PF00932
  6. 2765007Protein automated matches [191072] (1 species)
    not a true protein
  7. 2765008Species Human (Homo sapiens) [TaxId:9606] [188979] (3 PDB entries)
  8. 2765009Domain d3gefa1: 3gef A:436-552 [176576]
    Other proteins in same PDB: d3gefa2, d3gefb2, d3gefc2, d3gefd2
    automated match to d1ivta_
    mutant

Details for d3gefa1

PDB Entry: 3gef (more details), 1.5 Å

PDB Description: crystal structure of the r482w mutant of lamin a/c
PDB Compounds: (A:) Lamin-A/C

SCOPe Domain Sequences for d3gefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gefa1 b.1.16.1 (A:436-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqvv
tiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved

SCOPe Domain Coordinates for d3gefa1:

Click to download the PDB-style file with coordinates for d3gefa1.
(The format of our PDB-style files is described here.)

Timeline for d3gefa1: