Lineage for d3ge8h_ (3ge8 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978091Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2978092Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2978098Domain d3ge8h_: 3ge8 H: [176575]
    Other proteins in same PDB: d3ge8a_, d3ge8c_, d3ge8d_, d3ge8g_
    automated match to d1g10a_
    complexed with act, fe

Details for d3ge8h_

PDB Entry: 3ge8 (more details), 2.19 Å

PDB Description: toluene 4-monooxygenase hd t201a diferric, resting state complex
PDB Compounds: (H:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3ge8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge8h_ d.137.1.1 (H:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
tladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrk
tleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d3ge8h_:

Click to download the PDB-style file with coordinates for d3ge8h_.
(The format of our PDB-style files is described here.)

Timeline for d3ge8h_: