Lineage for d3ge8g_ (3ge8 G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1196311Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1196332Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 1196333Protein automated matches [190991] (1 species)
    not a true protein
  7. 1196334Species Pseudomonas mendocina [TaxId:300] [188696] (13 PDB entries)
  8. 1196350Domain d3ge8g_: 3ge8 G: [176574]
    Other proteins in same PDB: d3ge8a_, d3ge8d_, d3ge8e_, d3ge8h_
    automated match to d1t0rc_
    complexed with act, fe

Details for d3ge8g_

PDB Entry: 3ge8 (more details), 2.19 Å

PDB Description: toluene 4-monooxygenase hd t201a diferric, resting state complex
PDB Compounds: (G:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3ge8g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge8g_ d.15.12.0 (G:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d3ge8g_:

Click to download the PDB-style file with coordinates for d3ge8g_.
(The format of our PDB-style files is described here.)

Timeline for d3ge8g_: