Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
Protein automated matches [190991] (1 species) not a true protein |
Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries) |
Domain d3ge8g_: 3ge8 G: [176574] Other proteins in same PDB: d3ge8a_, d3ge8d_, d3ge8e_, d3ge8h_ automated match to d1t0rc_ complexed with act, fe |
PDB Entry: 3ge8 (more details), 2.19 Å
SCOPe Domain Sequences for d3ge8g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge8g_ d.15.12.0 (G:) automated matches {Pseudomonas mendocina [TaxId: 300]} safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf prdmtiaesglnptevidvvfe
Timeline for d3ge8g_: