![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
![]() | Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) ![]() duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
![]() | Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
![]() | Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species) |
![]() | Species Pseudomonas mendocina [TaxId:300] [64395] (14 PDB entries) |
![]() | Domain d3ge8e_: 3ge8 E: [176573] Other proteins in same PDB: d3ge8a_, d3ge8c_, d3ge8d_, d3ge8g_ automated match to d1g10a_ complexed with act, fe |
PDB Entry: 3ge8 (more details), 2.19 Å
SCOPe Domain Sequences for d3ge8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge8e_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]} stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
Timeline for d3ge8e_: