Lineage for d3ge8d_ (3ge8 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990411Species Pseudomonas mendocina [TaxId:300] [188695] (20 PDB entries)
  8. 1990429Domain d3ge8d_: 3ge8 D: [176572]
    Other proteins in same PDB: d3ge8c_, d3ge8e_, d3ge8g_, d3ge8h_
    automated match to d1t0qa_
    complexed with act, fe

Details for d3ge8d_

PDB Entry: 3ge8 (more details), 2.19 Å

PDB Description: Toluene 4-monooxygenase HD T201A diferric, resting state complex
PDB Compounds: (D:) Toluene-4-monooxygenase system protein A

SCOPe Domain Sequences for d3ge8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge8d_ a.25.1.2 (D:) automated matches {Pseudomonas mendocina [TaxId: 300]}
amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
grdaisvaimltfsfetgfanmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
dahdfawadk

SCOPe Domain Coordinates for d3ge8d_:

Click to download the PDB-style file with coordinates for d3ge8d_.
(The format of our PDB-style files is described here.)

Timeline for d3ge8d_: