Lineage for d3ge4g_ (3ge4 G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 2313377Protein automated matches [190041] (28 species)
    not a true protein
  7. 2313434Species Brucella melitensis [TaxId:29459] [188807] (1 PDB entry)
  8. 2313441Domain d3ge4g_: 3ge4 G: [176561]
    automated match to d1o9ra_
    complexed with ca

Details for d3ge4g_

PDB Entry: 3ge4 (more details), 1.7 Å

PDB Description: Crystal structure of ferritin:DNA-binding protein DPS from Brucella Melitensis
PDB Compounds: (G:) DNA protection during starvation protein

SCOPe Domain Sequences for d3ge4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge4g_ a.25.1.1 (G:) automated matches {Brucella melitensis [TaxId: 29459]}
smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
rksikdaddagdddtadiftaasrsldkalwfleahvqesn

SCOPe Domain Coordinates for d3ge4g_:

Click to download the PDB-style file with coordinates for d3ge4g_.
(The format of our PDB-style files is described here.)

Timeline for d3ge4g_: