Lineage for d3ge4f_ (3ge4 F:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911451Protein automated matches [190041] (18 species)
    not a true protein
  7. 911501Species Brucella melitensis [TaxId:29459] [188807] (1 PDB entry)
  8. 911507Domain d3ge4f_: 3ge4 F: [176560]
    automated match to d1o9ra_
    complexed with ca

Details for d3ge4f_

PDB Entry: 3ge4 (more details), 1.7 Å

PDB Description: Crystal structure of ferritin:DNA-binding protein DPS from Brucella Melitensis
PDB Compounds: (F:) DNA protection during starvation protein

SCOPe Domain Sequences for d3ge4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge4f_ a.25.1.1 (F:) automated matches {Brucella melitensis [TaxId: 29459]}
smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
rksikdaddagdddtadiftaasrsldkalwfleahvqesn

SCOPe Domain Coordinates for d3ge4f_:

Click to download the PDB-style file with coordinates for d3ge4f_.
(The format of our PDB-style files is described here.)

Timeline for d3ge4f_: