SCOP 1.75: Domain d1gsbd1: 1gsb D:85-217

Lineage for d1gsbd1 (1gsb D:85-217)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d1gsbd1: 1gsb D:85-217 [17656]
   Other proteins in same PDB: d1gsba2, d1gsbb2, d1gsbc2, d1gsbd2
   CA-atoms only

Details for d1gsbd1

PDB Entry: 1gsb, 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

PDB Compounds: (D:) glutathione s-transferase

SCOP Domain Sequences for d1gsbd1:

Sequence; same for both SEQRES and ATOM records:

>d1gsbd1 a.45.1.1 (D:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d1gsbd1:

• d1gsbd1 first appeared (with stable ids) in SCOP 1.55
  
• d1gsbd1 appears in SCOP 1.73
  
• d1gsbd1 appears in SCOPe 2.01
  
• d1gsbd1 appears in the current release, SCOPe 2.08