Lineage for d3ge4d_ (3ge4 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728561Species Brucella melitensis [TaxId:29459] [188807] (1 PDB entry)
  8. 1728565Domain d3ge4d_: 3ge4 D: [176558]
    automated match to d1o9ra_
    complexed with ca

Details for d3ge4d_

PDB Entry: 3ge4 (more details), 1.7 Å

PDB Description: Crystal structure of ferritin:DNA-binding protein DPS from Brucella Melitensis
PDB Compounds: (D:) DNA protection during starvation protein

SCOPe Domain Sequences for d3ge4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge4d_ a.25.1.1 (D:) automated matches {Brucella melitensis [TaxId: 29459]}
smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
rksikdaddagdddtadiftaasrsldkalwfleahvqesn

SCOPe Domain Coordinates for d3ge4d_:

Click to download the PDB-style file with coordinates for d3ge4d_.
(The format of our PDB-style files is described here.)

Timeline for d3ge4d_: