SCOPe 2.01: Domain d3ge3e_: 3ge3 E:

Lineage for d3ge3e_ (3ge3 E:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [64395] (14 PDB entries)

8. Domain d3ge3e_: 3ge3 E: [176554]
   Other proteins in same PDB: d3ge3a_, d3ge3c_
   automated match to d1g10a_
   complexed with act, cl, fe; mutant

Details for d3ge3e_

PDB Entry: 3ge3, 1.52 Å

PDB Description: crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex

PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3ge3e_:

Sequence; same for both SEQRES and ATOM records:

>d3ge3e_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d3ge3e_:

• d3ge3e_ is new in SCOPe 2.01-stable
  
• d3ge3e_ appears in SCOPe 2.02
  
• d3ge3e_ appears in the current release, SCOPe 2.08