Lineage for d3gdtd_ (3gdt D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079288Protein automated matches [190130] (11 species)
    not a true protein
  7. 2079289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188935] (5 PDB entries)
  8. 2079297Domain d3gdtd_: 3gdt D: [176551]
    automated match to d1dqwa_
    complexed with up6; mutant

Details for d3gdtd_

PDB Entry: 3gdt (more details), 1.6 Å

PDB Description: Crystal structure of the D91N mutant of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae complexed with 6-azauridine 5'-monophosphate
PDB Compounds: (D:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3gdtd_:

Sequence, based on SEQRES records: (download)

>d3gdtd_ c.1.2.3 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
katykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthv
diltdfsmegtvkplkalsakynfllfenrkfadigntvklqysagvyriaewaditnah
gvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigf
iaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfakgr
dakvegeryrkagweaylrrcgqq

Sequence, based on observed residues (ATOM records): (download)

>d3gdtd_ c.1.2.3 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
katykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthv
diltdfsmegtvkplkalsakynfllfenrkfadigntvklqysagvyriaewaditnah
gvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigf
iaqrdmggrdegydwlimtpgvgrtvddvvstgsdiiivgrglfakgrdakvegeryrka
gweaylrrcgqq

SCOPe Domain Coordinates for d3gdtd_:

Click to download the PDB-style file with coordinates for d3gdtd_.
(The format of our PDB-style files is described here.)

Timeline for d3gdtd_: