Lineage for d3gdma_ (3gdm A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1815849Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1815989Protein automated matches [190130] (11 species)
    not a true protein
  7. 1815990Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188935] (5 PDB entries)
  8. 1815991Domain d3gdma_: 3gdm A: [176542]
    automated match to d1dqwa_
    mutant

Details for d3gdma_

PDB Entry: 3gdm (more details), 1.6 Å

PDB Description: crystal structure of the k93r mutant of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3gdma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gdma_ c.1.2.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
katykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthv
diltdfsmegtvkplkalsakynfllfedrrfadigntvklqysagvyriaewaditnah
gvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigf
iaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfakgr
dakvegeryrkagweaylrrc

SCOPe Domain Coordinates for d3gdma_:

Click to download the PDB-style file with coordinates for d3gdma_.
(The format of our PDB-style files is described here.)

Timeline for d3gdma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gdmb_