Lineage for d3gdlb_ (3gdl B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1143783Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1143927Protein automated matches [190130] (9 species)
    not a true protein
  7. 1143928Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188935] (5 PDB entries)
  8. 1143932Domain d3gdlb_: 3gdl B: [176541]
    automated match to d1dqwa_
    complexed with up6

Details for d3gdlb_

PDB Entry: 3gdl (more details), 1.65 Å

PDB Description: Crystal structure of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae complexed with 6-azauridine 5'-monophosphate
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3gdlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gdlb_ c.1.2.3 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthvdi
ltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditnahgv
vgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigfia
qrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfakgrda
kvegeryrkagweaylr

SCOPe Domain Coordinates for d3gdlb_:

Click to download the PDB-style file with coordinates for d3gdlb_.
(The format of our PDB-style files is described here.)

Timeline for d3gdlb_: