Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein automated matches [190130] (9 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188935] (5 PDB entries) |
Domain d3gdlb_: 3gdl B: [176541] automated match to d1dqwa_ complexed with up6 |
PDB Entry: 3gdl (more details), 1.65 Å
SCOPe Domain Sequences for d3gdlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gdlb_ c.1.2.3 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthvdi ltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditnahgv vgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigfia qrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfakgrda kvegeryrkagweaylr
Timeline for d3gdlb_: