SCOPe 2.08: Domain d3gdla_: 3gdl A:

Lineage for d3gdla_ (3gdl A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188935] (5 PDB entries)

8. Domain d3gdla_: 3gdl A: [176540]
   automated match to d1dqwa_
   complexed with up6

Details for d3gdla_

PDB Entry: 3gdl, 1.65 Å

PDB Description: Crystal structure of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae complexed with 6-azauridine 5'-monophosphate

PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3gdla_:

Sequence; same for both SEQRES and ATOM records:

>d3gdla_ c.1.2.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthvdi
ltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditnahgv
vgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigfia
qrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfakgrda
kvegeryrkagweaylr

Timeline for d3gdla_:

• d3gdla_ first appeared in SCOPe 2.01
  
• d3gdla_ appears in SCOPe 2.07