Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries) |
Domain d1gsbb1: 1gsb B:85-217 [17654] Other proteins in same PDB: d1gsba2, d1gsbb2, d1gsbc2, d1gsbd2 CA-atoms only |
PDB Entry: 1gsb (more details), 2.5 Å
SCOPe Domain Sequences for d1gsbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsbb1 a.45.1.1 (B:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]} lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls tpifsklaqwsnk
Timeline for d1gsbb1: