Lineage for d3gdjd_ (3gdj D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717893Species Camel (Camelus dromedarius) [TaxId:9838] [189249] (1 PDB entry)
  8. 1717897Domain d3gdjd_: 3gdj D: [176535]
    automated match to d1aj9b_
    complexed with hem

Details for d3gdjd_

PDB Entry: 3gdj (more details), 2 Å

PDB Description: crystal structure determination of camel(camelus dromedarius) hemoglobin at 2 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3gdjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gdjd_ a.1.1.2 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vhlsgdeknavhglwskvkvdevggealgrllvvypwtrrffesfgdlstadavmnnpkv
kahgskvlnsfgdglnhldnlkgtyaklselhcdklhvdpenfrllgnvlvvvlarhfgk
eftpdlqaayqkvvagvanalahryh

SCOPe Domain Coordinates for d3gdjd_:

Click to download the PDB-style file with coordinates for d3gdjd_.
(The format of our PDB-style files is described here.)

Timeline for d3gdjd_: