Lineage for d3gdja_ (3gdj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688588Species Camel (Camelus dromedarius) [TaxId:9838] [189249] (1 PDB entry)
  8. 2688589Domain d3gdja_: 3gdj A: [176533]
    automated match to d1bz1a_
    complexed with hem

Details for d3gdja_

PDB Entry: 3gdj (more details), 2 Å

PDB Description: crystal structure determination of camel(camelus dromedarius) hemoglobin at 2 angstrom resolution
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gdja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gdja_ a.1.1.2 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vlsskdktnvktafgkigghaaeygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltkaadhlddlpsalsalsdlhahklrvdpvnfkllshcllvtvaahhpgdftps
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d3gdja_:

Click to download the PDB-style file with coordinates for d3gdja_.
(The format of our PDB-style files is described here.)

Timeline for d3gdja_: