SCOPe 2.04: Domain d3gdfc_: 3gdf C:

Lineage for d3gdfc_ (3gdf C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Cladosporium herbarum [TaxId:29918] [189335] (2 PDB entries)

8. Domain d3gdfc_: 3gdf C: [176527]
   automated match to d1vl8a_
   complexed with zn

Details for d3gdfc_

PDB Entry: 3gdf, 2.5 Å

PDB Description: Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum.

PDB Compounds: (C:) Probable NADP-dependent mannitol dehydrogenase

SCOPe Domain Sequences for d3gdfc_:

Sequence; same for both SEQRES and ATOM records:

>d3gdfc_ c.2.1.0 (C:) automated matches {Cladosporium herbarum [TaxId: 29918]}
mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga
eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg
sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka
gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg
ayvyfasdastyttgadllidggyttr

Timeline for d3gdfc_:

• d3gdfc_ first appeared in SCOPe 2.01
  
• d3gdfc_ appears in SCOPe 2.03
  
• d3gdfc_ appears in SCOPe 2.05
  
• d3gdfc_ appears in the current release, SCOPe 2.08