Lineage for d3gbsa_ (3gbs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (103 species)
    not a true protein
  7. 2476671Species Fungus (Aspergillus oryzae) [TaxId:5062] [189066] (2 PDB entries)
  8. 2476673Domain d3gbsa_: 3gbs A: [176506]
    automated match to d1cuya_

Details for d3gbsa_

PDB Entry: 3gbs (more details), 1.75 Å

PDB Description: Crystal structure of Aspergillus oryzae cutinase
PDB Compounds: (A:) Cutinase 1

SCOPe Domain Sequences for d3gbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbsa_ c.69.1.0 (A:) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
ltggdelrdgpckpitfifarastepgllgistgpavcnrlklarsgdvacqgvgpryta
dlpsnalpegtsqaaiaeaqglfeqavskcpdtqivaggysqgtavmngaikrlsadvqd
kikgvvlfgytrnaqergqianfpkdkvkvycavgdlvclgtlivapphfsylsdtgdas
dfllsql

SCOPe Domain Coordinates for d3gbsa_:

Click to download the PDB-style file with coordinates for d3gbsa_.
(The format of our PDB-style files is described here.)

Timeline for d3gbsa_: