Lineage for d3gboa_ (3gbo A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212308Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 1212344Protein automated matches [190837] (2 species)
    not a true protein
  7. 1212345Species Bothrops moojeni [TaxId:98334] [189045] (1 PDB entry)
  8. 1212346Domain d3gboa_: 3gbo A: [176505]
    automated match to d1nd1a_
    complexed with ca, zn

Details for d3gboa_

PDB Entry: 3gbo (more details), 1.77 Å

PDB Description: Crystal structure of BmooMPalpha-I, a non-hemorrhagic metalloproteinase isolated from Bothrops moojeni snake venom
PDB Compounds: (A:) Zinc metalloproteinase BmooMPalfa-I

SCOPe Domain Sequences for d3gboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gboa_ d.92.1.9 (A:) automated matches {Bothrops moojeni [TaxId: 98334]}
fsprhielvvvadhgmfkkynsnlntirkwvhemvnsmngfyrsvdvtaslanlevwskk
dlinvqkdsretlksfgewrerdllprishdnaqllttivfdghvigraftggmcdprhs
vgvvmdhspknlqvavtmahelghnlgmhhdgnqchcdaascimadslsqvlsyefsdcs
qnqyqtyltkhnpqcilnep

SCOPe Domain Coordinates for d3gboa_:

Click to download the PDB-style file with coordinates for d3gboa_.
(The format of our PDB-style files is described here.)

Timeline for d3gboa_: