Lineage for d3gbna_ (3gbn A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531230Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (6 PDB entries)
  8. 1531234Domain d3gbna_: 3gbn A: [176504]
    Other proteins in same PDB: d3gbnb_, d3gbnl1
    automated match to d1rd8a_
    complexed with cl, edo, etx, gol, nag, unl

Details for d3gbna_

PDB Entry: 3gbn (more details), 2.2 Å

PDB Description: Crystal Structure of Fab CR6261 in Complex with the 1918 H1N1 influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3gbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbna_ b.19.1.2 (A:) Hemagglutinin {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
pvtigecpkyvrstklrmatglrnipsi

SCOPe Domain Coordinates for d3gbna_:

Click to download the PDB-style file with coordinates for d3gbna_.
(The format of our PDB-style files is described here.)

Timeline for d3gbna_: