Lineage for d3gbmc1 (3gbm C:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040351Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [190025] (2 PDB entries)
  8. 2040354Domain d3gbmc1: 3gbm C:11-324 [176503]
    Other proteins in same PDB: d3gbma2, d3gbmb1, d3gbmb2, d3gbmc2, d3gbmd_, d3gbml1, d3gbml2, d3gbmm1, d3gbmm2
    automated match to d2fk0a1
    complexed with bma, edo, gol, nag

Details for d3gbmc1

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: Crystal Structure of Fab CR6261 in Complex with a H5N1 influenza virus hemagglutinin.
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d3gbmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbmc1 b.19.1.2 (C:11-324) Hemagglutinin {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3gbmc1:

Click to download the PDB-style file with coordinates for d3gbmc1.
(The format of our PDB-style files is described here.)

Timeline for d3gbmc1: