Lineage for d3gbma_ (3gbm A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305771Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [190025] (2 PDB entries)
  8. 1305773Domain d3gbma_: 3gbm A: [176502]
    Other proteins in same PDB: d3gbml1, d3gbml2, d3gbmm1, d3gbmm2
    automated match to d2fk0a1
    complexed with bma, edo, gol, nag

Details for d3gbma_

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: Crystal Structure of Fab CR6261 in Complex with a H5N1 influenza virus hemagglutinin.
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3gbma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbma_ b.19.1.2 (A:) Hemagglutinin {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
pksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwg
ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnd
ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
tigecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3gbma_:

Click to download the PDB-style file with coordinates for d3gbma_.
(The format of our PDB-style files is described here.)

Timeline for d3gbma_: