Lineage for d3gbla_ (3gbl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754245Species Ctenopharyngodon idella [TaxId:7959] [189272] (2 PDB entries)
  8. 2754246Domain d3gbla_: 3gbl A: [176501]
    automated match to d1a1mb_

Details for d3gbla_

PDB Entry: 3gbl (more details), 2.1 Å

PDB Description: Crystal structure of grass carp Beta2-microglobulin
PDB Compounds: (A:) beta2-microglobulin

SCOPe Domain Sequences for d3gbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbla_ b.1.1.0 (A:) automated matches {Ctenopharyngodon idella [TaxId: 7959]}
kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw
qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm

SCOPe Domain Coordinates for d3gbla_:

Click to download the PDB-style file with coordinates for d3gbla_.
(The format of our PDB-style files is described here.)

Timeline for d3gbla_: