| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
| Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
| Protein automated matches [190672] (10 species) not a true protein |
| Species Staphylococcus epidermidis [TaxId:176280] [188805] (1 PDB entry) |
| Domain d3gbhd_: 3gbh D: [176495] automated match to d2b67a1 complexed with ca, fmn, gol, pge, unl |
PDB Entry: 3gbh (more details), 2 Å
SCOPe Domain Sequences for d3gbhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gbhd_ d.90.1.0 (D:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
qkltrindfnevlnsrksvkvfdenykipreemdeiitkatkapssvnmqpwriavvqsd
emkekvkesfgfnsrqlttssamliifgdlqnyekaeqiygdaveqqlmtedikaqlldw
ilpyyknlsregmkdivnidsslmamqlmltakahgydtnpiggfdkeniadiigydsdr
yvpvlaiaigkkaqdahdsvrlpiddvrefl
Timeline for d3gbhd_: