Lineage for d3gbhd_ (3gbh D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211817Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1211818Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1211927Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 1211928Protein automated matches [190672] (10 species)
    not a true protein
  7. 1211952Species Staphylococcus epidermidis [TaxId:176280] [188805] (1 PDB entry)
  8. 1211956Domain d3gbhd_: 3gbh D: [176495]
    automated match to d2b67a1
    complexed with ca, fmn, gol, pge, unl

Details for d3gbhd_

PDB Entry: 3gbh (more details), 2 Å

PDB Description: crystal structure of a putative nad(p)h:fmn oxidoreductase (se1966) from staphylococcus epidermidis atcc 12228 at 2.00 a resolution
PDB Compounds: (D:) NAD(P)H-flavin oxidoreductase

SCOPe Domain Sequences for d3gbhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbhd_ d.90.1.0 (D:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
qkltrindfnevlnsrksvkvfdenykipreemdeiitkatkapssvnmqpwriavvqsd
emkekvkesfgfnsrqlttssamliifgdlqnyekaeqiygdaveqqlmtedikaqlldw
ilpyyknlsregmkdivnidsslmamqlmltakahgydtnpiggfdkeniadiigydsdr
yvpvlaiaigkkaqdahdsvrlpiddvrefl

SCOPe Domain Coordinates for d3gbhd_:

Click to download the PDB-style file with coordinates for d3gbhd_.
(The format of our PDB-style files is described here.)

Timeline for d3gbhd_: