SCOPe 2.02: Domain d3gbhb_: 3gbh B:

Lineage for d3gbhb_ (3gbh B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (10 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176280] [188805] (1 PDB entry)

8. Domain d3gbhb_: 3gbh B: [176493]
   automated match to d2b67a1
   complexed with ca, fmn, gol, pge, unl

Details for d3gbhb_

PDB Entry: 3gbh, 2 Å

PDB Description: crystal structure of a putative nad(p)h:fmn oxidoreductase (se1966) from staphylococcus epidermidis atcc 12228 at 2.00 a resolution

PDB Compounds: (B:) NAD(P)H-flavin oxidoreductase

SCOPe Domain Sequences for d3gbhb_:

Sequence; same for both SEQRES and ATOM records:

>d3gbhb_ d.90.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
gmqkltrindfnevlnsrksvkvfdenykipreemdeiitkatkapssvnmqpwriavvq
sdemkekvkesfgfnsrqlttssamliifgdlqnyekaeqiygdaveqqlmtedikaqll
dwilpyyknlsregmkdivnidsslmamqlmltakahgydtnpiggfdkeniadiigyds
dryvpvlaiaigkkaqdahdsvrlpiddvrefl

Timeline for d3gbhb_:

• d3gbhb_ first appeared in SCOPe 2.01
  
• d3gbhb_ appears in SCOPe 2.03
  
• d3gbhb_ appears in the current release, SCOPe 2.08, called d3gbhb1