Lineage for d3gayb_ (3gay B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086683Species Giardia intestinalis [TaxId:5741] [187874] (6 PDB entries)
  8. 2086687Domain d3gayb_: 3gay B: [176488]
    automated match to d1rv8a_
    complexed with p6t, zn

Details for d3gayb_

PDB Entry: 3gay (more details), 1.8 Å

PDB Description: Structure of Giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate
PDB Compounds: (B:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3gayb_:

Sequence, based on SEQRES records: (download)

>d3gayb_ c.1.10.0 (B:) automated matches {Giardia intestinalis [TaxId: 5741]}
plctlrqmlgearkhkygvgafnvnnmeqiqgimkavvqlkspvilqcsrgalkysdmiy
lkklceaalekhpdipicihldhgdtlesvkmaidlgfssvmidashhpfdenvritkev
vayahargvsveaelgtlggieedvqntvqltepqdakkfveltgvdalavaigtshgay
kfksesdirlaidrvktisdltgiplvmhgsssvpkdvkdminkyggkmpdavgvpiesi
vhaigegvckinvdsdsrmamtgairkvfvehpekfdprdylgpgrdaitemlipkikaf
gsaghagdykvvsleeakawyk

Sequence, based on observed residues (ATOM records): (download)

>d3gayb_ c.1.10.0 (B:) automated matches {Giardia intestinalis [TaxId: 5741]}
plctlrqmlgearkhkygvgafnvnnmeqiqgimkavvqlkspvilqcsrgalkysdmiy
lkklceaalekhpdipicihldhgdtlesvkmaidlgfssvmidashhpfdenvritkev
vayahargvsveaelgtlggientvqltepqdakkfveltgvdalavaigtshgaykfks
esdirlaidrvktisdltgiplvmhgsssvpkdvkdminkyggkmpdavgvpiesivhai
gegvckinvdsdsrmamtgairkvfvehpekfdprdylgpgrdaitemlipkikafgsag
hagdykvvsleeakawyk

SCOPe Domain Coordinates for d3gayb_:

Click to download the PDB-style file with coordinates for d3gayb_.
(The format of our PDB-style files is described here.)

Timeline for d3gayb_: