Lineage for d3gaxa_ (3gax A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161469Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2161502Family d.17.1.2: Cystatins [54407] (7 protein domains)
    automatically mapped to Pfam PF00031
  6. 2161536Protein Cystatin C [64231] (1 species)
  7. 2161537Species Human (Homo sapiens) [TaxId:9606] [64232] (9 PDB entries)
    Uniprot P01034 37-146
  8. 2161538Domain d3gaxa_: 3gax A: [176485]
    automated match to d1g96a_

Details for d3gaxa_

PDB Entry: 3gax (more details), 1.7 Å

PDB Description: crystal structure of monomeric human cystatin c stabilized against aggregation
PDB Compounds: (A:) Cystatin-C

SCOPe Domain Sequences for d3gaxa_:

Sequence, based on SEQRES records: (download)

>d3gaxa_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
gpmdasveeegvrraldfavgeynkasndmyhsracqvvrarkqivagvnyfldvelcrt
tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Sequence, based on observed residues (ATOM records): (download)

>d3gaxa_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
gpmdasveeegvrraldfavgeynkasndmyhsracqvvrarkqivagvnyfldvelcrt
tctktqldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d3gaxa_:

Click to download the PDB-style file with coordinates for d3gaxa_.
(The format of our PDB-style files is described here.)

Timeline for d3gaxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gaxb_