SCOPe 2.08: Domain d3gaxa_: 3gax A:

Lineage for d3gaxa_ (3gax A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin C [64231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64232] (11 PDB entries)
   Uniprot P01034 37-146

8. Domain d3gaxa_: 3gax A: [176485]
   automated match to d1g96a_

Details for d3gaxa_

PDB Entry: 3gax, 1.7 Å

PDB Description: crystal structure of monomeric human cystatin c stabilized against aggregation

PDB Compounds: (A:) Cystatin-C

SCOPe Domain Sequences for d3gaxa_:

Sequence, based on SEQRES records:

>d3gaxa_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
gpmdasveeegvrraldfavgeynkasndmyhsracqvvrarkqivagvnyfldvelcrt
tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Sequence, based on observed residues (ATOM records):

>d3gaxa_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
gpmdasveeegvrraldfavgeynkasndmyhsracqvvrarkqivagvnyfldvelcrt
tctktqldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Timeline for d3gaxa_:

• d3gaxa_ first appeared in SCOPe 2.01
  
• d3gaxa_ appears in SCOPe 2.07