SCOP 1.65: Domain d5fwgb1: 5fwg B:85-217

Lineage for d5fwgb1 (5fwg B:85-217)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d5fwgb1: 5fwg B:85-217 [17648]
   Other proteins in same PDB: d5fwga2, d5fwgb2
   complexed with cyp, ftr; mutant

Details for d5fwgb1

PDB Entry: 5fwg, 2 Å

PDB Description: tetra-(5-fluorotryptophanyl)-glutathione transferase

SCOP Domain Sequences for d5fwgb1:

Sequence; same for both SEQRES and ATOM records:

>d5fwgb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pxfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqxsnk

Timeline for d5fwgb1:

• d5fwgb1 first appeared (with stable ids) in SCOP 1.55
  
• d5fwgb1 appears in SCOP 1.63
  
• d5fwgb1 appears in SCOP 1.67
  
• d5fwgb1 appears in the current release, SCOPe 2.08