Lineage for d3gaja_ (3gaj A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 912326Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 912345Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 912346Protein automated matches [190652] (3 species)
    not a true protein
  7. 912351Species Lactobacillus reuteri [TaxId:1598] [188444] (8 PDB entries)
  8. 912354Domain d3gaja_: 3gaj A: [176478]
    automated match to d1rtyb_
    complexed with atp, b12, k, mg

Details for d3gaja_

PDB Entry: 3gaj (more details), 1.38 Å

PDB Description: structure of a c-terminal deletion variant of a pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp
PDB Compounds: (A:) Cobalamin adenosyltransferase PduO-like protein

SCOPe Domain Sequences for d3gaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gaja_ a.25.2.0 (A:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla
salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr

SCOPe Domain Coordinates for d3gaja_:

Click to download the PDB-style file with coordinates for d3gaja_.
(The format of our PDB-style files is described here.)

Timeline for d3gaja_: